PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_18518_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 354aa    MW: 39696.4 Da    PI: 6.5091
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_18518_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-171462148
                                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+W++eEd +l+ +++q+G+g +W + ++++g++R++k+c++rw++yl
  cra_locus_18518_iso_1_len_1237_ver_3 14 KGPWSPEEDAKLKAYIEQHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                                          79*********************************************97 PP

2Myb_DNA-binding37.55.5e-1269111246
                                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_18518_iso_1_len_1237_ver_3  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                                           569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.783962IPR017930Myb domain
SuperFamilySSF466891.06E-2611109IPR009057Homeodomain-like
SMARTSM007173.2E-131364IPR001005SANT/Myb domain
PfamPF002499.8E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-251569IPR009057Homeodomain-like
CDDcd001676.96E-101662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002491.3E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2370117IPR009057Homeodomain-like
CDDcd001676.42E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE QHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
HRKEIQSRRN NKQISQEMKK GSASRDNYCN NYNNNPYWSA ETVPNNVLPP IPYSNEEPRF  180
NDHTSIRKLL IKLGGRFSSQ DDDDDDQLPI NPHYNIFPAA PEMFSSAPLI DNCLTAAPGP  240
EMECNYKVEG GVDNVAMGST GGGGGESSNF AYELEQMIYN NPQKFEGLEF LCGDIFLMNN  300
YNNNYNRGDF GGGIMSSGWS EMMSSMVLPS SVVSNNSNYE DSGDDHLMRY NAGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002301137.21e-121hypothetical protein POPTR_0002s11440g
SwissprotQ9M2Y92e-85RAX3_ARATH; Transcription factor RAX3
TrEMBLJ7FAY51e-126J7FAY5_QUESU; R2R3-MYB transcription factor MYB1.1
STRINGPOPTR_0002s11440.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154